PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof015270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family HD-ZIP
Protein Properties Length: 200aa    MW: 21125 Da    PI: 10.7962
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-298133726PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox46.56.4e-15134187255
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                rk+ +++k+q  +Lee+F+ +++++ +++  LA++lgL    V vW qNrRa+ 
  Sof015270 134 RKKLRLSKDQAVVLEECFKTHSTLNPKQKLALATRLGLRPXEVEVWLQNRRART 187
                778899**********************************************96 PP

2HD-ZIP_I/II89.15.6e-29134199166
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaL 66 
                  +kk+rlsk+q+ +LEe+F+++++L+p++K +la++Lgl+p  v+vW qnrRARt++kq+E+d+++L
    Sof015270 134 RKKLRLSKDQAVVLEECFKTHSTLNPKQKLALATRLGLRPXEVEVWLQNRRARTQLKQTEVDCQYL 199
                  69**************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007114.171130190IPR001356Homeobox domain
SMARTSM003896.4E-10132194IPR001356Homeobox domain
SuperFamilySSF466893.72E-14133198IPR009057Homeodomain-like
CDDcd000867.94E-10134186No hitNo description
PfamPF000462.3E-12134187IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.9E-13134187IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MMPRTSGASL DLGLSLGLGL TSQGSLSSST TTAGSSSPWA AALSSVVADV ARARDVDAHA  60
HYHAASAAAA AGLDLVDPAD RAAMRASTSP DSAAALSSGA SGDNTNKRDR ELQRTGSGGV  120
RSNRRTARTA LAXRKKLRLS KDQAVVLEEC FKTHSTLNPK QKLALATRLG LRPXEVEVWL  180
QNRRARTQLK QTEVDCQYLX
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.190490.0crown| inflorescence| root| seed| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002436446.11e-68hypothetical protein SORBIDRAFT_10g002750
SwissprotQ5VPE31e-40HOX2_ORYSJ; Homeobox-leucine zipper protein HOX2
SwissprotQ84U861e-40HOX2_ORYSI; Homeobox-leucine zipper protein HOX2
TrEMBLC5Z3S71e-68C5Z3S7_SORBI; Putative uncharacterized protein Sb10g002750
STRINGSb10g002750.13e-68(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44910.15e-27homeobox-leucine zipper protein 4